PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G016633.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 309aa    MW: 34248.9 Da    PI: 7.4221
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G016633.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-173481148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT eEde+lv+ v+++G ++W+  a+  g++Rt+k+c++rw +yl
  Sobic.009G016633.1.p 34 KGPWTDEEDEQLVRFVRLFGERRWDFLAKVSGLRRTGKSCRLRWVNYL 81
                          79********************************************97 PP

2Myb_DNA-binding521.6e-1687130146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rgr T++E+ ++v++++q+G++ W++Iar ++ gRt++++k++w++
  Sobic.009G016633.1.p  87 RGRITADEERRIVELHAQWGSR-WSRIARSLP-GRTDNEIKNFWRT 130
                           899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.6142985IPR017930Myb domain
SuperFamilySSF466896.36E-2832128IPR009057Homeodomain-like
SMARTSM007171.1E-153383IPR001005SANT/Myb domain
PfamPF002493.4E-153481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-203588IPR009057Homeodomain-like
CDDcd001671.19E-103681No hitNo description
PROSITE profilePS5129418.14386136IPR017930Myb domain
SMARTSM007174.7E-1386134IPR001005SANT/Myb domain
PfamPF002491.1E-1387130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2289135IPR009057Homeodomain-like
CDDcd001678.76E-991130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSSSLLCRRR NHKKDGDGEH QIIISTSTPA AMRKGPWTDE EDEQLVRFVR LFGERRWDFL  60
AKVSGLRRTG KSCRLRWVNY LHPGLRRGRI TADEERRIVE LHAQWGSRWS RIARSLPGRT  120
DNEIKNFWRT RTRKKALEER RAAGAAAAVT ATAEPAASSS SSVTMISECR PGSPNSGAAT  180
TSSSSGGSSS SLREERPGDE DAELEEASTA TTAAGTTKQQ QQQQQPLPQE YYDGCSTMDQ  240
LWNEIAAADA AAMSYVVDAC WNGAGHYYYG AAAAEPPPAS PPWEYCGPDF SLWRIDDQEY  300
YKKMLDSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-26341364105C-Myb DNA-Binding Domain
1mse_C6e-26341364105C-Myb DNA-Binding Domain
1gv2_A6e-26341364105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.141450.0callus| root| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283601e-154KJ728360.1 Zea mays clone pUT6642 MYB transcription factor (MYB62) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008647513.11e-115PREDICTED: uncharacterized protein LOC100272853 isoform X1
SwissprotQ9LX824e-59MYB48_ARATH; Transcription factor MYB48
TrEMBLK7UIU31e-115K7UIU3_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G013581_P011e-114(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP1995322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-51myb domain protein 59